HORDB

ID: hor006621
Uniprot ID: P0C0P8
Protein name: Neuropeptide S precursor
Gene name: Nps
Organism: Mus musculus (Mouse)
Family: NA
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0032230 positive regulation of synaptic transmission, GABAergic; GO:0035249 synaptic transmission, glutamatergic; GO:0045760 positive regulation of action potential; GO:0051968 positive regulation of synaptic transmission, glutamatergic
GO CC: GO:0005576 extracellular region; GO:0045202 synapse

Sequence: YPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTSFRRAKQ
Length: 66(24-89)
Propeptide: MIGSLKLSFVLALSLSVMHVLWCYPVLSSKVPGKPDYFLILLSSCPARLEGSDRLAFLKPILEKTSMKRSFRNGVGSGAKKTSFRRAKQ
Signal peptide: MIGSLKLSFVLALSLSVMHVLWC
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May play an important anorexigenic role. Modulates arousal and anxiety as well as increases locomotor activity. Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations.
Mechanism: NA
Cross BBB: NA
Target: Npsr1
Target Unid: Q8BZP8
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006621_AF2.pdb

hor006621_ESM.pdb

Mass:	849016	Formula:	C330H542N94O90S2
Absent amino acids:	HW	Common amino acids:	SKL
pI:	11.23	Basic residues:	14
Polar residues:	20	Hydrophobic residues:	21
Hydrophobicity:	-38.79	Boman Index:	-12437
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	78.33
Instability Index:	5245.76	Extinction Coefficient cystines:	2980
Absorbance 280nm:	45.85